DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or67b

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:184 Identity:40/184 - (21%)
Similarity:77/184 - (41%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YQSNLSLLRVFLDEFRSVLRQESPGLIPR-LAFYYVRAFLSLLCQYPNKKLASLPLYRWINLFIM 69
            |:|.|..:..||     |....|..|:|: ....|::..:.|..:..:.......|:::| :.:.
  Fly   240 YESGLIKVLRFL-----VQNSTSDILVPKDQRVKYLQCCVRLFARISSHHNQIENLFKYI-ILVQ 298

  Fly    70 CNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVF-----TKIFYMHLRCDEIDE----LISD 125
            |:|.:|...|.  |.:...|:|:|  .||: ||.:|:     .:|...::...:::.    |..|
  Fly   299 CSVSSILICML--LYKISTVLEVG--WVWM-GMIMVYFVTIALEITLYNVSAQKVESQSELLFHD 358

  Fly   126 F---EYYNRELRPHNIDEEVLGWQRLCYVIESG--------LYINCFCL-VNFF 167
            :   .:||.......:.:.:|.:.|..:|:..|        ..:..|.| .|||
  Fly   359 WYNCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTSLSHKFLVQVFRLSANFF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 22/101 (22%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 36/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.