DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or63a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:353 Identity:67/353 - (18%)
Similarity:138/353 - (39%) Gaps:52/353 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GDDLVWISGMALVFTKIF-----YMHLRCDEIDELISDFEYYNR--------ELRPH-------- 136
            |..|.:::.:|.::..:|     |..||.....||:...|.:.|        |:|..        
  Fly    79 GTALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRY 143

  Fly   137 --NIDEEVLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGK----LPFHSVYPFQWHRL 195
              :...::|.:...|..|.:..:||.| ::|.:  ..|.:|   :|.    ||..|:||...|:.
  Fly   144 WASTRRQILIYLYSCICITTNYFINSF-VINLY--RYFTKP---KGSYDIMLPLPSLYPAWEHKG 202

  Fly   196 DLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGIS---TFLQTALNLKLLCIEIRKLGDMEVS--- 254
            ...||....:|:        ...|:.:..|..:|   .|:...|:...|...:.::.:...|   
  Fly   203 LEFPYYHIQMYL--------ETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELV 259

  Fly   255 --DKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMA- 316
              |:|.....|.:.:: |.:.....:.|..|......|.:.|.....::.|:.......:..:. 
  Fly   260 PPDRRVEYLRCCIYQY-QRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITM 323

  Fly   317 AKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMY 381
            .:..:.::.|..|:.::|.:|....|.|.|:|.|.:.:. |:.:|...:..|..:::|..:....
  Fly   324 IRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVR-WYGESREFRHLIRMMLMRTNRGFRL 387

  Fly   382 VAEPFLPFTLGTYMLVLKNCYRLLALMQ 409
            ....|:..:|.|.|.:::...:...|:|
  Fly   388 DVSWFMQMSLPTLMAMVRTSGQYFLLLQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 65/344 (19%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 65/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.