DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or59c

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:430 Identity:83/430 - (19%)
Similarity:153/430 - (35%) Gaps:118/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FYYVRAFLSLLCQYPNKKLASLPLYRWI-NLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWIS 100
            :||..||  .|...|.|.    .|.||| :|:    .:|..|...|.||               .
  Fly    26 YYYRIAF--FLGWTPPKG----ALLRWIYSLW----TLTTMWLGIVYLP---------------L 65

  Fly   101 GMALVFTKIF------------YMHLRCDEIDELISDFEYYNRELRPHNIDEEVLGWQRLC---- 149
            |::|.:.|.|            .:.:.|  |..:|.....|::..|...::|.:....:.|    
  Fly    66 GLSLTYVKHFDRFTPTEFLTSLQVDINC--IGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTT 128

  Fly   150 ---------------YVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPF-QWHRLDLH 198
                           .::....|:. ||.:..|::..       .||.|:....|. .|.:   .
  Fly   129 QRRIFHKMVARVNLIVILFLSTYLG-FCFLTLFTSVF-------AGKAPWQLYNPLVDWRK---G 182

  Fly   199 PYTFWFLYIWQSLTSQHNLMSILMVD---MVGISTFLQTALNLKLLCIEIRKL-GDMEVSDKRFH 259
            .:..|...|.:........|..||.|   :|.||.|   ..:|.:|...|..| .|.::|:...:
  Fly   183 HWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLF---RCHLAILRDRIANLRQDPKLSEMEHY 244

  Fly   260 EEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAAKFVLLML 324
            |:....::.|:.||:.             :|::.  .::||:.|.......:|..:||..:|   
  Fly   245 EQMVACIQDHRTIIQC-------------SQIIR--PILSITIFAQFMLVGIDLGLAAISIL--- 291

  Fly   325 VAFIQLSLWCVSGTLVY-------------------TQSVEVAQAAFDINDWHTKSPGIQRDISF 370
              |...::|.:...:.:                   ..||.|:.|.|..| |.|.....:..:.:
  Fly   292 --FFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSN-WITADRSYKSAVLY 353

  Fly   371 VILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQE 410
            .:.|||:|:.:.|....|.::.:.:.|.|..:.::.::.:
  Fly   354 FLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 66/368 (18%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 62/342 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.