DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or56a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:440 Identity:86/440 - (19%)
Similarity:152/440 - (34%) Gaps:141/440 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NKKLASLPLYRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIF------ 110
            |:.|.||         |.|.::|.                    .:|:| .||:..::|      
  Fly    38 NRPLLSL---------IRCTILTA--------------------SIWLS-CALMLARVFRGYENL 72

  Fly   111 ------------YM---------HLRCDEIDELI----SDF-----EYYNRELRPHNIDEEVLGW 145
                        |.         :::.|::..|:    ||.     |..|||:      |.::..
  Fly    73 NDGATSYATAVQYFAVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADNREM------ELLVAT 131

  Fly   146 QRLCYVIE---------SGL--YINCFCLVNFFSAAIFLQPLLGEGK---LPFHSVYPF------ 190
            |.....|.         :||  |.:|.....|...::|..|.:..|:   :....::||      
  Fly   132 QAYTRTITLLIWIPSVIAGLMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPILLFQLFPFGELCDN 196

  Fly   191 -------QWHRLDL--HPYTFWFLYIWQSLTSQHNL-MSIL--MVDMVGISTFLQTALNLKLLCI 243
                   .|:.|.|  .....|..:| ..|....|| :.||  .|:.:.|     |.||.||:  
  Fly   197 FVVGYLGPWYALGLGITAIPLWHTFI-TCLMKYVNLKLQILNKRVEEMDI-----TRLNSKLV-- 253

  Fly   244 EIRKLGDMEVSD---------KRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLIS 299
                :|.:..|:         |.|.:|..|:.:|.|.:..|:           ...:||.|.:.|
  Fly   254 ----IGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLI-----------CVPVMADFIIFS 303

  Fly   300 ISTFETMAAAAVDPKMAAKFVLLMLVAFIQLS-LWCV--SGTLVYTQSVEVAQAAFDINDWHTKS 361
            :.......|..|.......:..:.:..|:... ||..  ..||:.....|::.|.|... |:...
  Fly   304 VLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDELSLAYFSCG-WYNFE 367

  Fly   362 PGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQES 411
            ..:|:.:.|:::.||:| |.:....:...|.|::.:.:..|....|::.|
  Fly   368 MPLQKMLVFMMMHAQRP-MKMRALLVDLNLRTFIDIGRGAYSYFNLLRSS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 76/393 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 62/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.