DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or49a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:387 Identity:77/387 - (19%)
Similarity:151/387 - (39%) Gaps:56/387 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PLYRWI---NLFIMCNVMTIF-----------WTMFVALPESKNVIEMGDDLVWISGMALVFTKI 109
            |.:|::   ..|::|.:...:           |......|  ..::..|....::....|.|...
  Fly    31 PWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAGSP--SKIMRQGLHFFYMLSSQLKFITF 93

  Fly   110 FYMHLRCDEIDELISDFEYYNRELRPHNIDE----EVLGWQRLCYVIESGLYINCFCLVNFFSAA 170
            .....|..::...:       :||.||....    ||..:...|.. .:.||:..|.:|     .
  Fly    94 MINRKRLLQLSHRL-------KELYPHKEQNQRKYEVNKYYLSCST-RNVLYVYYFVMV-----V 145

  Fly   171 IFLQP--------LLGEGKLPF--HSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDM 225
            :.|:|        |:|.||..|  ..::|.:.......|..:...|:.....||..:...|..|:
  Fly   146 MALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYSQFIVNVSLGTDL 210

  Fly   226 VGISTFLQTALNLKLLC---IEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAF 287
            ..:....|.:::|..|.   ..||...:.|..|..|   ...:::.||.:|:|....|..|....
  Fly   211 WMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDF---LASIIKRHQLMIRLQKDVNYVFGLLL 272

  Fly   288 NAQLMASFSLISISTFETMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVS--GTLVYTQSVEVAQA 350
            .:.|..:..|:....:.|:    |:.........:||.|.:....:.||  |.::...|..:|:|
  Fly   273 ASNLFTTSCLLCCMAYYTV----VEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKA 333

  Fly   351 AFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQESM 412
            ||: :.|:..|...:::|..::.:||:||...|...:..:|.|:.:::...||..|::::::
  Fly   334 AFE-SKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQTV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 68/332 (20%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 67/316 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.