DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or45a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:406 Identity:88/406 - (21%)
Similarity:163/406 - (40%) Gaps:68/406 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AFYYV--RAFLSLLCQYPNKKLASLPLYRWINLFIMCNVMTIFWTMFV-ALPESKNVIEMGDDL- 96
            |.|:.  |..|.::...|:....||....|..:.|: ::::..|.|.| ||.:..::..:.|:. 
  Fly     3 ASYFAVQRRALEIVGFDPSTPQLSLKHPIWAGILIL-SLISHNWPMVVYALQDLSDLTRLTDNFA 66

  Fly    97 VWISGMALVFTKIFYMHLRCDEIDELISDFEYYNR--ELRPHNIDEEVLGWQRLCYVIESGLYIN 159
            |::.|....| |...|..:...|..||......|:  ...|:::::           ||....::
  Fly    67 VFMQGSQSTF-KFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEK-----------IERENQLD 119

  Fly   160 CFCLVNFFSAAI------FLQP-LLG------EGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSL 211
            .:...:|.:||.      .:.| |||      .|.....:...|.:...:..|:.:|.:|:|..|
  Fly   120 RYVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYVWGVL 184

  Fly   212 ---------TSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDMEVSDKRFHEEFCRVVR 267
                     .:...|.|.|..::|.....|:..|..|          |:...|.|    ....|.
  Fly   185 GVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEEK----------DLNGGDSR----LTGFVS 235

  Fly   268 FHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFE-TMAAAAVDPKMAAKFVLLMLVAFIQLS 331
            .|:..:.|..:.:..|......:.|.|:..:.:..|. :.:..:......|.|::.::   ||||
  Fly   236 RHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRATFLVAII---IQLS 297

  Fly   332 LWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKP-----LMYVAE-PFLPF- 389
            .:|..|..:..||:.:|||.:...:|...:|..:|....||:|||:|     .|:|.: |.|.: 
  Fly   298 SYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGFMFVVDLPLLLWV 362

  Fly   390 --TLGTYMLVLKNCYR 403
              |.|:::.:|:...|
  Fly   363 IRTAGSFLAMLRTFER 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 73/348 (21%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 70/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.