DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or42b

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:413 Identity:80/413 - (19%)
Similarity:160/413 - (38%) Gaps:105/413 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLDEFRSVLRQESPGLIPRLAFYYVRAFLSLL--CQYPNKKLASLPLYRWINLFIMCNVMTIFWT 78
            ||..:.:.::..|||           .||:.|  |               ||.:.....:.|.::
  Fly    64 FLGSYMTQIKSFSPG-----------EFLTSLQVC---------------INAYGSSVKVAITYS 102

  Fly    79 MFVALPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISDFEYYNRELRPHNIDEEVL 143
            |...|.::||:::..|                   |||..::|         || :.|.:     
  Fly   103 MLWRLIKAKNILDQLD-------------------LRCTAMEE---------RE-KIHLV----- 133

  Fly   144 GWQRLCYVIESGLYINCFCLVNF----FSAAIFLQPLLGEGKLPFHSVYPFQWHRLDLHPYTFWF 204
                   |..|.   :.|.:..|    ::.:.:|..:| .|:.|:....||    :|.|..|   
  Fly   134 -------VARSN---HAFLIFTFVYCGYAGSTYLSSVL-SGRPPWQLYNPF----IDWHDGT--- 180

  Fly   205 LYIWQSLTSQHNLMS-ILMVDMVG-----ISTFLQTALNLKLLCIEIRKL-GDMEVSDKRFHEEF 262
            |.:|.:.|.::.:|| .::.|.:.     |.|.:..| :|.:|...||:| .|..:|:...:||.
  Fly   181 LKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLILRA-HLDMLRERIRRLRSDENLSEAESYEEL 244

  Fly   263 CRVVRFHQHIIKLVGKANRAFNGAFNAQ-----LMASFSLISISTFETMAAAAVDPKMAAKFVLL 322
            .:.|..|:.|::..........|....|     |:..|:||::..|..:...      .|.|:.:
  Fly   245 VKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTG------IASFMFV 303

  Fly   323 MLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFL 387
            :.: .:|...:|.:..|:......:..|.|..| |...|...:..:.:.:...|:|::::|....
  Fly   304 ITI-LLQTFPFCYTCNLIMEDCESLTHAIFQSN-WVDASRRYKTTLLYFLQNVQQPIVFIAGGIF 366

  Fly   388 PFTLGTYMLVLKNCYRLLALMQE 410
            ..::.:.:.|.|..:.::.:.::
  Fly   367 QISMSSNISVAKFAFSVITITKQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 65/329 (20%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 78/391 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.