DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or35a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:456 Identity:86/456 - (18%)
Similarity:143/456 - (31%) Gaps:167/456 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KLA-SLPLYRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCD 117
            ||| .|.::|..::|...:..|..|..::             |.|....|:|||.:.....||  
  Fly    15 KLAWPLAVFRLNHIFWPLDPSTGKWGRYL-------------DKVLAVAMSLVFMQHNDAELR-- 64

  Fly   118 EIDELISDFEYYNRELRPHNIDEEVLGWQRLCYVIES---GLYINCFCLVNF---------FSAA 170
                      |...|....|:|..:.|......::|:   .|:|    |::|         |.|.
  Fly    65 ----------YLRFEASNRNLDAFLTGMPTYLILVEAQFRSLHI----LLHFEKLQKFLEIFYAN 115

  Fly   171 IFLQP--------------------------------------LLGEGK-LPFHSVYPFQWHRLD 196
            |::.|                                      ::.:.| ..:..::||     |
  Fly   116 IYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFPF-----D 175

  Fly   197 LHP-YTFWFLY---IWQSLT------SQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDM 251
            ..| |.|..|.   :|..:.      .:.||:..|:|.:.|....|:..|.|.:           
  Fly   176 SDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAI----------- 229

  Fly   252 EVSDKRFHEEFCRVVRFHQHIIK----LVGKA---NRAFNGAFNAQLMASFSLISISTFETMAAA 309
                     |...|.|...|:.|    |:.|.   |.|.| .|..||.|.:   ::..|...|.|
  Fly   230 ---------EKILVARDRPHMAKQLKVLITKTLRKNVALN-QFGQQLEAQY---TVRVFIMFAFA 281

  Fly   310 A-----------VDPK--------MAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDIN 355
            |           .:|.        ..||.|.|       |||..:...|.:|  .:.....:.:.
  Fly   282 AGLLCALSFKAYTNPMANYIYAIWFGAKTVEL-------LSLGQIGSDLAFT--TDSLSTMYYLT 337

  Fly   356 DW-----HTKSPG----IQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLK---NCYRLLALM 408
            .|     ::.:|.    :.:.|:..|....||.......:...:|...:.:|:   :.:..|..|
  Fly   338 HWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402

  Fly   409 Q 409
            |
  Fly   403 Q 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 75/412 (18%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 65/360 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.