DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or33c

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:405 Identity:75/405 - (18%)
Similarity:144/405 - (35%) Gaps:110/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LIPRLAFYYVRAFLSLLCQYPNKKLASLPLYRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDD 95
            |:|..|.::....:||.|                   :.|::..:  .....||:   ::|: :.
  Fly    57 LLPSTAEFFKNLTMSLTC-------------------VACSLKHV--AHLYHLPQ---IVEI-ES 96

  Fly    96 LVWISGMALVFTKIFYMHLRCDEIDELIS---DFEYYNRELRPHNIDEEVLGWQRL--CYVIESG 155
            |:                   :::|..|:   :..||...:..|.        :|.  |      
  Fly    97 LI-------------------EQLDTFIASEQEHRYYRDHVHCHA--------RRFTRC------ 128

  Fly   156 LYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSI 220
            |||:...:...|...:|:|.:.|..:|.:.:.:||     ||....|     ..::...:.:.|:
  Fly   129 LYISFGMIYALFLFGVFVQVISGNWELLYPAYFPF-----DLESNRF-----LGAVALGYQVFSM 183

  Fly   221 LMVDMVGISTFLQTALNLKLLC-------IEIRKLG----DMEVSDKR---FHEEFCRVVRFHQH 271
            |:....|:.....|.|.|.||.       |.:.:||    :..|:.:|   :.|:...:||||..
  Fly   184 LVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHKLLVRFHNL 248

  Fly   272 IIKLVGKANRAFNGAFNAQL--MASFSLISISTFETMAAAAVDPKMAAKFVLLMLVAFIQLSLWC 334
            :.:.:.:......|...|.|  :.|:.|..:.          |......:::...|..:||...|
  Fly   249 VSRTISEVQLVQLGGCGATLCIIVSYMLFFVG----------DTISLVYYLVFFGVVCVQLFPSC 303

  Fly   335 VSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVIL------RAQKPLMYVAEPFLPFTLGT 393
            ...:.|..:...:..|.|. :.|:.:|    ||..|.:|      ...:..:..|...:...|..
  Fly   304 YFASEVAEELERLPYAIFS-SRWYDQS----RDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNA 363

  Fly   394 YMLVLKNCYRLLALM 408
            :...||..|.|.|::
  Fly   364 FFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 63/340 (19%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 70/394 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.