DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or30a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523520.2 Gene:Or30a / 34236 FlyBaseID:FBgn0032096 Length:377 Species:Drosophila melanogaster


Alignment Length:285 Identity:66/285 - (23%)
Similarity:109/285 - (38%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RLCYVIES-GLYINCFCLVNFFSAAIFLQPLLG-EGKLPFHSVYPFQWHRLDLH----PYTFWFL 205
            ||..:|.. .|.:.|...:.|.:     .|:.| |..||:....|    .:|.:    ||...|.
  Fly   120 RLSVLISRINLLMGCCTCIGFVT-----YPIFGSERVLPYGMYLP----TIDEYKYASPYYEIFF 175

  Fly   206 YIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDMEVSDKRFHEEFC------- 263
            .|...:......|.|...:|| ::..|...|..::|..::|.|..::....|....:|       
  Fly   176 VIQAIMAPMGCCMYIPYTNMV-VTFTLFAILMCRVLQHKLRSLEKLKNEQVRGEIIWCIKYQLKL 239

  Fly   264 -------RVVRFHQHIIKLVGKANRAFNGAFNAQL-MASFSLISISTF-ETMAAAAVDPKMAAKF 319
                   ..:..|.|:::.:         .|.|.| :..||||...|. :|:...|....:.|..
  Fly   240 SGFVDSMNALNTHLHLVEFL---------CFGAMLCVLLFSLIIAQTIAQTVIVIAYMVMIFANS 295

  Fly   320 VLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAE 384
            |:|..||           ..:|.||.::|.||::.| |.......|:.:.|:|:|:||||..:..
  Fly   296 VVLYYVA-----------NELYFQSFDIAIAAYESN-WMDFDVDTQKTLKFLIMRSQKPLAILVG 348

  Fly   385 PFLPFTLGTYMLVLKNCYRLLALMQ 409
            ...|..|.....:|...|....|::
  Fly   349 GTYPMNLKMLQSLLNAIYSFFTLLR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 64/276 (23%)
Or30aNP_523520.2 7tm_6 58..366 CDD:251636 64/276 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.