DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or22c

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:110/270 - (40%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 SAAIFLQPLL-----------GEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSIL 221
            :||..||||:           |:.:|||:.:.|    ...:.|..|...|:..:.:....:.:..
  Fly   145 NAAFTLQPLIMGLYRWIVQLPGQTELPFNIILP----SFAVQPGVFPLTYVLLTASGACTVFAFS 205

  Fly   222 MVDMVGISTFLQTALNLKLLCIEIRKL-----GDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANR 281
            .||...|.:.|......:|:..:||::     ||   |...|.||....||  ..:.::|.:.|.
  Fly   206 FVDGFFICSCLYICGAFRLVQQDIRRIFADLHGD---SVDVFTEEMNAEVR--HRLAQVVERHNA 265

  Fly   282 AFNGAFNAQLMASFSLISISTFETMAAAAV------------DPKMAAKFVLLMLVAFIQLSLWC 334
            ..:  |...|...|::|.:..|  ::||.|            .......::..::.|..||.|:|
  Fly   266 IID--FCTDLTRQFTVIVLMHF--LSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYC 326

  Fly   335 VSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPF----LP------F 389
            ..|..|...|..||...:|: :|: |.....|.:..:|||..:....:|.||    ||      .
  Fly   327 FGGNHVSESSAAVADVLYDM-EWY-KCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILS 389

  Fly   390 TLGTYMLVLK 399
            |.|:|:.:||
  Fly   390 TAGSYITLLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 66/270 (24%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 62/261 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.