DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or22b

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:428 Identity:81/428 - (18%)
Similarity:157/428 - (36%) Gaps:110/428 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RLAFYYV-RAFLSLLCQYPNKKLASLPLYRW-INLFIMCNVMTIFWTMFVALPESKNV------- 89
            |.||.|: |...|.....|..|       || ::..:....:|:.  :|:.||.|.:|       
  Fly    21 RDAFVYLDRVMWSFGWTVPENK-------RWDLHYKLWSTFVTLL--IFILLPISVSVEYIQRFK 76

  Fly    90 ----------IEMGDDLVWISGMALVFTKIFY-----MHLRCDEIDE-LISDFEYYNRELRPHNI 138
                      |::|.:: :.|......|.:.|     ..:..||:|: .:.|.|   |.:...::
  Fly    77 TFSAGEFLSSIQIGVNM-YGSSFKSYLTMMGYKKRQEAKMSLDELDKRCVCDEE---RTIVHRHV 137

  Fly   139 DEEVLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPFQWHRLDLHPYTFW 203
               .||  ..||:.....|.: |.:.||.|                     |...|  :|.:..:
  Fly   138 ---ALG--NFCYIFYHIAYTS-FLISNFLS---------------------FIMKR--IHAWRMY 173

  Fly   204 FLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDMEV--------------- 253
            |.|:  ....|..:.||..|.:.|.:.|:.       ||.::..|..|.:               
  Fly   174 FPYV--DPEKQFYISSIAEVILRGWAVFMD-------LCTDVCPLISMVIARCHITLLKQRLRNL 229

  Fly   254 ------SDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQ-----LMASFSLISISTFETMA 307
                  ::..:.:|....||.|:.|:..|......|:|....|     ::...|:|:|..|.|::
  Fly   230 RSEPGRTEDEYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLS 294

  Fly   308 AAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVI 372
            ....       .||.|....:|...:|....::.....|:|.:.|. :||.:.....:..:.:.:
  Fly   295 TGVA-------VVLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQ-SDWTSADRRYKSTLVYFL 351

  Fly   373 LRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQE 410
            ...|:|::..|....|.::.|.:.::|..:.::.::::
  Fly   352 HNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIVKQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 66/362 (18%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 65/349 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.