DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or65b

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:418 Identity:114/418 - (27%)
Similarity:212/418 - (50%) Gaps:28/418 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QSNLSLLRVFLDEFRSVLRQESPGLIPRLAFYYVRAFLSLLCQYPNKKLASLPLYR--WINLFIM 69
            |..|...:|....:|..|.:.|...|     ||.|..:..:..:...:...|| ||  |..| :.
  Fly     4 QRFLKFYKVGWKTYRDPLMEASHSSI-----YYWREQMKAMALFTTTEERLLP-YRSKWHTL-VY 61

  Fly    70 CNVMTIFWTMFVALPESK-NVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISDFEYYN--R 131
            ..::..|.:|...|.||. :.::||.||.:|.|...:..|.:|.....||:|::|||.:..:  .
  Fly    62 IQMVIFFASMSFGLTESMGDHVQMGRDLAFILGAFFIIFKTYYFCWYGDELDQVISDLDALHPWA 126

  Fly   132 ELRPHNIDEE-------VLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYP 189
            :..|:.::.:       |:.:    ::..|..:..|..|:...::.:::.    :..||||:.:|
  Fly   127 QKGPNPVEYQTGKRWYFVMAF----FLATSWSFFLCILLLLLITSPMWVH----QQNLPFHAAFP 183

  Fly   190 FQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDMEVS 254
            ||||...|||.:...:|::||..:.:.|..:|.::.:.|..:.:....:::||:|:|::......
  Fly   184 FQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYG 248

  Fly   255 DKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAAKF 319
            .:....|..|:|:.||.|::::.:.|..|:|....|:..:|||:|:|..|.:.|.. |||:.|:|
  Fly   249 LQELRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLSVLEAVEARK-DPKVVAQF 312

  Fly   320 VLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAE 384
            .:|||:|...||:|...|..:..:|:::::||::..|....|..:.||:..:|.|.|.||:..|.
  Fly   313 AVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKDVYRDLCVIIRRGQDPLIMRAS 377

  Fly   385 PFLPFTLGTYMLVLKNCYRLLALMQESM 412
            ||..|.|..|..:|..||.:|..:.:::
  Fly   378 PFPSFNLINYSAILNQCYGILTFLLKTL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 90/322 (28%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 90/320 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435200
Domainoid 1 1.000 94 1.000 Domainoid score I13837
eggNOG 1 0.900 - - E1_2C3M6
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I7282
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014300
OrthoInspector 1 1.000 - - otm49720
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.