DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or2a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:445 Identity:85/445 - (19%)
Similarity:158/445 - (35%) Gaps:129/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EFRSVLRQESPGLIPRL-AFYYVRAFLSLLCQYPNKKLASLPLYRWINLFIMCNVMTIFWTMFVA 82
            |...::|  .||:...| ..|.:...|.:...:|...||.| |:. .|:..:|..:||..|..||
  Fly    23 ELTGLMR--PPGVSSLLYVVYSITVNLVVTVLFPLSLLARL-LFT-TNMAGLCENLTITITDIVA 83

  Fly    83 LPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISDFEYYNRELRPHNIDEEVLGWQR 147
                                .|.|..::.:..:..||..|:   ...:...|.....||:     
  Fly    84 --------------------NLKFANVYMVRKQLHEIRSLL---RLMDARARLVGDPEEI----- 120

  Fly   148 LCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGKL-PFHSVYPF----QWHRLDLHP-----YTF 202
                                 :|:..:..:.:|.. .|.|::.|    ...|:.:.|     |..
  Fly   121 ---------------------SALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDRELLYPA 164

  Fly   203 WFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALN-----------------LKLLCIEIRKLG- 249
            ||...|...|..:.|::|..:    ....:|...|                 ::.|.:.:|::| 
  Fly   165 WFGVDWMHSTRNYVLINIYQL----FGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGC 225

  Fly   250 DMEVSDK-----RFHEEFCRVVRFHQHIIKL------VGKANRAFNGAFNAQLMASFSLISISTF 303
            ..|.|:|     .:.||      .:|.:|:.      |.:.........:...||.|        
  Fly   226 RTEKSNKGQTYEAWREE------VYQELIECIRDLARVHRLREIIQRVLSVPCMAQF-------- 276

  Fly   304 ETMAAAAVDPKMAAKF-----------VLLMLVAF----IQLSLWCVSGTLVYTQSVEVAQAAFD 353
              :.:|||...:|..|           :::.:|.|    :::.:.|..|..:.|||..:..|.:|
  Fly   277 --VCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYD 339

  Fly   354 INDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALM 408
            .| |..:.|..:|::.|.:.|.|:|.:..|..::..:|.|:..|::..|.:..|:
  Fly   340 CN-WIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 64/367 (17%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 71/390 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.