DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or19b

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster


Alignment Length:237 Identity:46/237 - (19%)
Similarity:94/237 - (39%) Gaps:40/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 YTFWFLYIWQSLTSQHNLMSILMVD--------MVGISTFLQTALNL-----KLLCIEIRKLG-D 250
            |..|..:.|:..||.:...::|...        ::.:|::..|.|.|     |.|.:.:.||| .
  Fly   158 YPTWIPWNWKDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYG 222

  Fly   251 MEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMAS------------FSLISISTF 303
            ..:...|........:..||.|::|.....|:.:.....|..::            |..:.|..|
  Fly   223 APLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRF 287

  Fly   304 ETMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDI 368
            ..|             :.|:::...:..|.|.:..|...:...:..|.:..| |.::|...:|.:
  Fly   288 MNM-------------LFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCN-WLSQSVNFRRLL 338

  Fly   369 SFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQE 410
            ..::.|.|.|::.|:...:|.::.|:.:::|..|.:|.|:.|
  Fly   339 LLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 42/227 (19%)
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 42/227 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.