DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and CG42526

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:214 Identity:54/214 - (25%)
Similarity:84/214 - (39%) Gaps:67/214 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEQLIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVS 67
            |..||..|.::..|:  :||:.       :|:.| :||..:|...:..|:.|:.|||.||:||| 
  Fly     5 DALLIASVKRNVSIF--EKYHT-------RYDRK-QAWIAVAQACQKSVEYCQIRWKSLRDRYV- 58

  Fly    68 QRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRH-----------VPNFLTSPQSANS----- 116
             |:...|.......|.:.| :.||.:||:.|:....           ||......|||:.     
  Fly    59 -RETQKPAATRSNIRKFKE-LDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALER 121

  Fly   117 SGYNEYQVDK---------------SNGSMKNVSQ-----------------FGSSGQSHLYHQP 149
            :|..|:|.|:               .|.|.:.:|:                 |...|||.     
  Fly   122 NGITEFQPDEFIIEYKGEEEYLSETDNSSAEFISEDSACNIGSELPYVTKPSFNGEGQSQ----- 181

  Fly   150 DQQHAMSALSNVAASALEN 168
            .|...||.: |:..|||::
  Fly   182 TQAKFMSVM-NLIESALKD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 28/90 (31%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.