DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and Adf1

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:251 Identity:56/251 - (22%)
Similarity:90/251 - (35%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEQLIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVS 67
            |..||:.|..:.|||:|..|      |...:..|.:.|:.||..|......|.||||.||:::..
  Fly    13 DLNLIEAVKLNPVIYDRSHY------NYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAR 71

  Fly    68 QRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRH--VPNFLTSPQSAN--------SSGYNEY 122
            :.|     :.:.....|.::|:||...|   :.||.  :.......||||        .....:.
  Fly    72 EMK-----LCQESRWRYFKQMQFLVDSI---RQYRESLLGKCANGSQSANQVADPSQQQQAQQQT 128

  Fly   123 QVD----KSNGSMKNVSQ-------------------FGSSGQSHLYHQP------DQQHAMSAL 158
            .||    ..|||....:|                   .|...:.:.|..|      :::|:.:.|
  Fly   129 VVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNML 193

  Fly   159 SNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHISQSQMQQQAAAVAAVMAD 214
            :.:.... .||:..|..| ||.|    ..|.:..|..:...|..:....:...:.|
  Fly   194 NTIKIFQ-NNVSQAVSAE-DQSF----GMVVTDMLNTLGVRQKAEAKVHIIKYLTD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 26/90 (29%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.