DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and hng2

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:246 Identity:56/246 - (22%)
Similarity:87/246 - (35%) Gaps:65/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QLIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVD------------TCKKR 57
            :.||.|.:..:|:.|..      .|....|.:|||||.|..:|.::.|            |..||
  Fly    20 EFIDAVHKRSIIWERSH------PNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKR 78

  Fly    58 WKYLRERY--VSQRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYN 120
            ||..|:.|  |::.:|....| ...|..|.:::.||                      .|....:
  Fly    79 WKNTRDSYLRVNRLRQSGEEV-ARASYIYEKELSFL----------------------LNVKAES 120

  Fly   121 EYQVD------KSNGSMKNVSQFGS-SGQSHLYHQPDQQHAMS-ALSNVAASALENVNGQVKIEA 177
            |..|:      |.....|.||.... |.::......||:..:. |:.|.|..:  |:|       
  Fly   121 EDDVESLKEQPKPQAKRKRVSTAAQRSAKTPRKRNSDQESNIEPAIRNPAIPS--NIN------- 176

  Fly   178 DQVFRDFAAA---VASQQLQHISQSQMQQQAAA-VAAVMADSSQGYQDQYK 224
             .|..|...|   .|:.::.:|.|.......:. .|.:.||..|.:.|..|
  Fly   177 -TVLGDLGCAKEDTATPEIAYIPQLPSDPPCSTNTAYLSADPDQAFFDTIK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 29/104 (28%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 27/98 (28%)
BESS 216..250 CDD:281011 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.