DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and Mes2

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:393 Identity:77/393 - (19%)
Similarity:131/393 - (33%) Gaps:118/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERY------VSQRKQGDPPVYEHLSRPYLEKMK 89
            |..|.|:.||:.|..:.........:.:|.|||.|      |.....|..|.:.     ..|.|.
  Fly    83 GAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRRELAHVKLMGNGFKPKWS-----LYEAMD 142

  Fly    90 FLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVDKSNGSMKNVSQFGSSGQSHLYHQPDQQHA 154
            ||...|:.||...|..:.     |..:.|:    ::.:|.:..|.:...:.|::......:..:.
  Fly   143 FLRDVIRERKGASHATDL-----SLTTYGH----INNNNNNNNNSNSLAAGGKAMTLKLSNSFNE 198

  Fly   155 MSALSNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHISQSQMQQQAAAVAAVMADSSQGY 219
            .:::.|::..:..||:.      |..:.|:                                  |
  Fly   199 SASVLNLSKCSSLNVSD------DHYYCDY----------------------------------Y 223

  Fly   220 QDQYKDGSVGMNGAQNSAGSLTSTSSSMKSPLSSPLQGIGAGSHHPQQQTQQQQQQQQQQAQQQS 284
            .....|.|||     ..|||.||.|||...||..|       :|.....::....:.:|:||..|
  Fly   224 VKPELDLSVG-----GGAGSSTSGSSSGGGPLPLP-------AHQAHNDSRVSSTRNEQRAQHHS 276

  Fly   285 PASEQQLPVVHSSSSATG-ASIGNSSTLQMQQSHV-----------YNPKGD---GLDSSSSSHF 334
            ...      :..||..:| ..|.::|.:..:...:           .|.:|.   |:|....|. 
  Fly   277 YED------MDDSSIRSGDEDIAHASDVVEELDAIDADFPYPLILDSNSRGSPNVGVDDVVMSR- 334

  Fly   335 HMKKPRIQLNGNAHNQMTSNGSHFGN---DSDDESDENSHDLMEPQAMMQQENHYSNSMPMQRGN 396
                   :|..|....:...|:..|:   |.||..::          |:||..|    :..|:|.
  Fly   335 -------KLRRNVDQDVLEEGNGHGDAVIDGDDYEEQ----------MLQQHRH----LRQQQGV 378

  Fly   397 GNG 399
            .:|
  Fly   379 ASG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 18/70 (26%)
Mes2NP_730768.1 MADF 62..149 CDD:214738 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.