DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and CG8765

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster


Alignment Length:484 Identity:100/484 - (20%)
Similarity:147/484 - (30%) Gaps:188/484 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEQLIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVS 67
            :::||..:.|..:|||      .|..|....:.|.|.|:.||.||:..|..|:.:||.||::|..
  Fly   316 EKELITLIQQEDMIYN------YGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAR 374

  Fly    68 QRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVDKSNGSMK 132
            :.|                :::.| .||.....::|               ||.....:.....|
  Fly   375 EHK----------------RLRTL-MHIDATSRWKH---------------YNSLSFLQKYIQQK 407

  Fly   133 NVSQFGSSGQSHLYHQPDQQHAMSALSNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHIS 197
            .:             :.|.|.:|....|.....||:                          |::
  Fly   408 TL-------------ESDSQLSMLLPKNDPVRELED--------------------------HMT 433

  Fly   198 QSQM--QQQAAAVAAVMADSSQGYQDQYKDGSVGMNGAQNSAGSLTSTSSSMKSPLSSPLQGIGA 260
            ||..  .||                                   :|..|||..|.|:.|......
  Fly   434 QSHSPPTQQ-----------------------------------ITLESSSSNSQLNLPTLPHLT 463

  Fly   261 GSHHPQQQTQQQQQQQQQQAQQQSPASEQQLPVVHSSSSATGASIGNSSTLQMQQSHVYNPKGDG 325
            |.|..:||.|||||::|.|.|||....:|                      |.|.|.:.....|.
  Fly   464 GPHKAEQQQQQQQQEEQHQQQQQHQQQQQ----------------------QQQASELCVATYDD 506

  Fly   326 LDSSSSSHFHMKKPRIQLNGNAHNQMTSNGSHFGNDSDDESDENSHDLME-----PQAMMQQENH 385
            :|..:           .:||:.|:          ||.|.|.||:..  ||     .|...||:.|
  Fly   507 MDIEN-----------YINGDVHH----------NDDDVEDDEDEE--METTTAAEQPPQQQDQH 548

  Fly   386 YSNSMPMQRGNG------NGNNSSSNSGSNNPSGNNSHNNQQQQQHQNMFPSNTDF--------L 436
            .   |.....:|      ....|:.:.......|..|..|||.|       |..:|        .
  Fly   549 V---MTYDHEDGPVYMAVPSVGSAMSKQEQLSDGATSLENQQLQ-------STAEFQKIEIQTPT 603

  Fly   437 FQLYQQFPHQASSSHPANFGKFQAPPNHP 465
            ...||......||:..:.:......|:.|
  Fly   604 TPRYQNAATTPSSTSTSRYHSAPITPSKP 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 25/90 (28%)
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 29/124 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.