DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and CG3919

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:338 Identity:73/338 - (21%)
Similarity:122/338 - (36%) Gaps:78/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VAQHGVIYNR-QKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVSQRKQGD 73
            |..|..:|:| ...||       :..|...||:.|:.::|..|.:||:||:.:|..|....|   
  Fly    25 VKLHPCLYDRHDDNYL-------RKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK--- 79

  Fly    74 PPVYEHLSRPYL-EKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVDKSNGSMKNVSQF 137
              ::...:..|| .::|||.:||.|     .||..|...:| ...|..|:........::.:.: 
  Fly    80 --LHHGANTYYLNSELKFLQKHITP-----GVPVPLRGRRS-RPKGQEEHDEGDPETPVEAILE- 135

  Fly   138 GSSGQSHLYHQP---DQQHAMSALSNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHISQS 199
                   :.|.|   :.:||.|..|...|||.:       :||.|...:              .|
  Fly   136 -------MVHSPSFLNSEHAQSRHSTDPASATD-------VEATQFNNE--------------PS 172

  Fly   200 QMQQQAAAVAAVMADSSQGYQDQYKDGSVGMNGAQNSAGSLTSTSSSMKSPL----SSPLQGIGA 260
            .:......|.|.|...|...:.:.|.|.:.:..........|||......|:    .:.|||:  
  Fly   173 SIMDFEDTVPAEMRTESDSSEKEAKVGEITLYRVPLLEFPKTSTRCIEALPIMDFDDAFLQGL-- 235

  Fly   261 GSHHPQQQTQQQQQQ----------------QQQQAQQQSPASEQQLPVVHSSSSATGASIGNSS 309
               .|:.:.....|:                .:|.|....||.......|:.:.|.| :|:.:::
  Fly   236 ---RPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQSASSTHPAQPHPRENVNGTLSTT-SSLSSAN 296

  Fly   310 TLQMQQSHVYNPK 322
            .||.....:..||
  Fly   297 PLQHMGLMLQLPK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 25/87 (29%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 24/86 (28%)
BESS 226..260 CDD:281011 5/38 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.