DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and CG4404

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:254 Identity:58/254 - (22%)
Similarity:101/254 - (39%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVSQRKQGDPPVYEHLSRPYLEK-MKFLDQHI 95
            |.|....|||.:|..::..|..|::||:.:|..::...|...........:.||.| ::||....
  Fly    38 KKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLVPFT 102

  Fly    96 QPRKSYRHVPNF-LTSP-QSANSSGYNEY-----QVDKSNGSMKNVSQFGSSGQSHLYHQPDQQH 153
            :.|..::.:|.. |..| |:|.:...:|.     :...|:|.|....|.  |.:.|..:|...:.
  Fly   103 KSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQV--SEEEHRRNQEQDRE 165

  Fly   154 AMSALSNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHISQSQMQQQAAAVAAVMADSSQG 218
            ..:|...:...:       :|:|.|       ::.|:|||:.:..   ||...:|.|....:..|
  Fly   166 QPTACLPLRLHS-------IKVEHD-------SSNANQQLERMVS---QQSLVSVPAAALGNHLG 213

  Fly   219 YQD--QYKDGSVGMNGAQNSAGSLTSTSSSMKSP----------LSSPLQGIGAGSHHP 265
            :.|  |:      ..|..:....||:|:::..||          ||....|.|.|...|
  Fly   214 WSDLTQW------FKGHGSGHHKLTTTTTTPTSPPPPPQPATSALSVFTGGPGGGGSQP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 17/64 (27%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 17/64 (27%)
BESS 267..301 CDD:281011 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.