DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and CG45071

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster


Alignment Length:446 Identity:84/446 - (18%)
Similarity:149/446 - (33%) Gaps:126/446 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EQLIDEVAQHGVIYNR----QKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRER 64
            ||.|.::.:...|:||    .|.:|            ::.|..::...:......|.:||.||:.
  Fly    13 EQFIHDIEERPAIWNRNFHCNKAFL------------EQMWDELSGAHKLPKIVLKAKWKGLRDN 65

  Fly    65 YVSQRKQ----------GDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVP------NFLTSPQS 113
            :..:.|:          .||..:|.....|. .:.||..|::.|     :|      :|..|.||
  Fly    66 FRVEYKRIPRADNGDFMVDPATFESKWLHYY-ALLFLTDHMRHR-----LPKNEQDQSFYFSQQS 124

  Fly   114 ANSSGYNEYQVDKSNGSMKNVSQFGSSGQSHLYHQPDQQHAMSALSNVAASALENVNGQVKIEAD 178
            .:.. ....:.|.:||.::.:.   .|.:.:      .:..|.|....:.:.:|..         
  Fly   125 EDCE-KTVVEPDLTNGLIRRLQ---DSDEDY------DEEEMEADGEASEATMEET--------- 170

  Fly   179 QVFRDFAAAVASQQLQHIS-----------QSQMQQQAAAVAAVMADSSQGYQDQYKDGSVGMNG 232
                 .....|:.|:..:|           |.:..|.|...|.::.......:.:.:|.|     
  Fly   171 -----MPTPPAAHQMNQVSTTPLATGALRAQEEAHQHALIKAGLLRAQLMELEKEAEDLS----- 225

  Fly   233 AQNSAGSLTSTSSSMKSPLSSPLQGI-----GAGSHHPQQQTQQQQQQQQQQAQQQSPASEQQLP 292
                  ........|.||::..||.:     ...|..|...|...|.||...|...:||:.... 
  Fly   226 ------RKPPPPQQMTSPVAPSLQVLVEPPAAHCSPPPMVTTTSAQVQQPGSAAVLAPATTTSA- 283

  Fly   293 VVHSSSSATGASIGNSSTLQMQQSHVYNPKGDGLDSSSSSHFHMKK------PRIQLNGNA-HNQ 350
               ||.|:.||.:|...:  :....:||.....|.:.:::|...|.      |...:.||. |..
  Fly   284 ---SSVSSNGAPMGGKRS--VSPPPLYNKAHHPLATLAAAHLAAKDRNEDFGPTSAVGGNGDHLS 343

  Fly   351 MT----SNG---------------SHFGNDSDDES-----DENSHDLMEPQAMMQQ 382
            .|    :||               |:|...|..::     |::.|.|:.....|:|
  Fly   344 FTQHSYANGLIPALKLKRPRLSEDSNFNGSSTMDTPLVPEDDDYHYLLSLHPYMKQ 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 21/104 (20%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 21/104 (20%)
BESS 384..418 CDD:281011 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.