DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and madf-10

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_492729.1 Gene:madf-10 / 190925 WormBaseID:WBGene00013717 Length:234 Species:Caenorhabditis elegans


Alignment Length:107 Identity:24/107 - (22%)
Similarity:43/107 - (40%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VDTCKKRWKYLRERYVSQRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSAN 115
            ::..:|.||.|::.||..|::   ..::|...|...|.||.|..:           ||      :
 Worm    99 IEEIEKHWKNLKDTYVKTRRK---LTFDHDGCPIRPKWKFFDSLM-----------FL------D 143

  Fly   116 SSGYNEYQVDKS----NGSMKNVSQFGSSGQSHLYHQPDQQH 153
            |...|::.:.|.    .|...::.|..||.:..|...|..::
 Worm   144 SVNQNDFVMKKRPMQFQGQPYDLYQGPSSKKEKLEEMPSDEY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 13/44 (30%)
madf-10NP_492729.1 MADF 53..147 CDD:214738 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.