DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7745 and madf-8

DIOPT Version :9

Sequence 1:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_497739.1 Gene:madf-8 / 183517 WormBaseID:WBGene00008118 Length:300 Species:Caenorhabditis elegans


Alignment Length:136 Identity:26/136 - (19%)
Similarity:46/136 - (33%) Gaps:41/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AWQLIAMKLRTDVD----TCKKRWKYLRERYVSQRKQGD-------------------------P 74
            ||..:.::|..|.:    ..|:.||..|:.:||.....:                         .
 Worm   163 AWDQLDLELGIDEEYPLARRKQIWKSKRDYFVSAVNAANLRKWIYADALEFYRPMINFRTTFCLR 227

  Fly    75 PVYEHLSRPYLEKMKFLDQHIQ--PRKSYRHVPNFL---------TSPQSANSSGYNEYQVDKSN 128
            |.....|:...:|:...|::||  |... ::|..||         :||:.....|....::.|.|
 Worm   228 PTVAQPSQSVHDKLVLADKNIQCTPGDK-KNVLTFLLKSLYDTGMSSPEMMAEHGLEILKIFKKN 291

  Fly   129 GSMKNV 134
            ....|:
 Worm   292 AESSNL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7745NP_610671.1 MADF 5..96 CDD:214738 14/85 (16%)
madf-8NP_497739.1 MADF 135..219 CDD:214738 10/55 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.