DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ING1 and bip2

DIOPT Version :9

Sequence 1:NP_005528.4 Gene:ING1 / 3621 HGNCID:6062 Length:422 Species:Homo sapiens
Sequence 2:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster


Alignment Length:328 Identity:65/328 - (19%)
Similarity:112/328 - (34%) Gaps:102/328 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   141 AVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRGWGRAWPWKQILKELDECYERFSRET 205
            ::.:.|.|.|...|.|.:::|:             |..:..|::..:....||:          |
  Fly  1133 SMTINPSLGAATSGISPNQIPK-------------LTLKLSGKSTLFSSSEKEM----------T 1174

Human   206 DGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFE--------AQQEL 262
            |..:.:      |..::.|                  ||:.|:.|:..||..        .:.:.
  Fly  1175 DAGKLK------QTTILSS------------------ENKKRERDNSPELARFSPLVTGPPKNKQ 1215

Human   263 GDT--AGNSGKAGADRPKGEAAAQADKPNSKRSRRQR---NNENRENASSN-------------- 308
            .:|  .|||..|....|...|......|.|:.|....   :|.|..|.:|:              
  Fly  1216 SETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASSTLSASSVLLPQQLM 1280

Human   309 ---HDHDD-------GASGTPKE-----KKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYC-L 357
               |...:       .::||..:     ....||::...:...||.....:.:..:.|....| .
  Fly  1281 LAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSSYVDAEGNRIWICPA 1345

Human   358 CNQVSYGE-MIGCDNDECPIEWFHFSCVGLNHKPKGK--WYCPKCRGENEKTMDKALEKSKKERA 419
            |.:|..|. |||||..:.   |:|:.|||:...||..  |:|..|      ...|.:..|:|::.
  Fly  1346 CGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVC------VTKKRIHGSEKKKR 1401

Human   420 YNR 422
            .|:
  Fly  1402 RNK 1404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ING1NP_005528.4 ING <189..254 CDD:289749 10/64 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..349 21/121 (17%)
PHD_ING1_2 355..399 CDD:277059 18/47 (38%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 405..422 3/16 (19%)
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 18/47 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.