DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fpps and BTS1

DIOPT Version :9

Sequence 1:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_015256.1 Gene:BTS1 / 856036 SGDID:S000005990 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:321 Identity:79/321 - (24%)
Similarity:124/321 - (38%) Gaps:73/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VTKAYNCSDAAKWFAQVLQYNVPRGKKNRGILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQ 165
            ::|.||         .:|   :..||..|  |.::...|.|  .:|..:.:.:...:   ||:|.
Yeast    23 ISKPYN---------HIL---LKPGKNFR--LNLIVQINRV--MNLPKDQLAIVSQI---VELLH 68

  Fly   166 SFFIISDDVMDNSTTRRGQPCWHKVENVGLTAINDALMIENAMYAILKKHFSHL----DCYVALM 226
            :..::.||:.||:..||||...|.:..|..| ||.|    |.||....:..|.|    ..|..|:
Yeast    69 NSSLLIDDIEDNAPLRRGQTTSHLIFGVPST-INTA----NYMYFRAMQLVSQLTTKEPLYHNLI 128

  Fly   227 ELFHEITYITTCGQSLDQLNSNRCVSEF--TMENYKAIVENKTAYYSFYLPFALALHLAGYKDAE 289
            .:|:|.......||.|| :.....:.|.  |.|.|..:|.|||...     |.|.|.|     .|
Yeast   129 TIFNEELINLHRGQGLD-IYWRDFLPEIIPTQEMYLNMVMNKTGGL-----FRLTLRL-----ME 182

  Fly   290 AFRQSK-------TILLEMGNFFQVQDDFLDC--FGNPEVTGKIGTDIQDNKCSWLAVVAMQ--- 342
            |...|.       ..:..:|..:|::||:|:.  |......| ...||.:.|.|:..|.|:.   
Yeast   183 ALSPSSHHGHSLVPFINLLGIIYQIRDDYLNLKDFQMSSEKG-FAEDITEGKLSFPIVHALNFTK 246

  Fly   343 -RANVEQ-----KQIMVDCYGKEEPAKVERVKELYKELGLPSTYAIFEEESYNMIKTHIQQ 397
             :...||     :.:::....|:...|:.::.|             |:..|....|..|.|
Yeast   247 TKGQTEQHNEILRILLLRTSDKDIKLKLIQILE-------------FDTNSLAYTKNFINQ 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 70/281 (25%)
BTS1NP_015256.1 polyprenyl_synt 20..278 CDD:395277 73/290 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.