DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fpps and COQ1

DIOPT Version :9

Sequence 1:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_009557.1 Gene:COQ1 / 852288 SGDID:S000000207 Length:473 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:56/248 - (22%)
Similarity:92/248 - (37%) Gaps:74/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KNRGILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRGQPCWHKVE 191
            |.||||               |:..:||:    .|||:.:..::.|||:|:|.||||:|..:...
Yeast   167 KQRGIL---------------PKQRRLAE----IVEMIHTASLLHDDVIDHSDTRRGRPSGNAAF 212

  Fly   192 NVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHEITYITTCGQSLDQLNSNRCVSEFTM 256
            ...:..:....::..|..:|.:.|...:   |.||.  :.|..:.. |:.:...|::......|:
Yeast   213 TNKMAVLAGDFLLGRATVSISRLHNPEV---VELMS--NSIANLVE-GEFMQLKNTSIDADIDTI 271

  Fly   257 EN-------------------------------YKAIVENKTAYY--SFYLPFA--------LAL 280
            ||                               :..|:|....||  ..||..|        .|.
Yeast   272 ENGHKLLPVPSKKLEVKEHDFRVPSRQQGLQLSHDQIIETAFEYYIHKTYLKTAALISKSCRCAA 336

  Fly   281 HLAGYKDA---EAFRQSKTILLEMGNFFQVQDDFLDCFGNPEVTGK-IGTDIQ 329
            .|:|...|   |.:...:    .:|..||:.||.||...:.:..|| .|.|::
Yeast   337 ILSGASPAVIDECYDFGR----NLGICFQLVDDMLDFTVSGKDLGKPSGADLK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 56/248 (23%)
COQ1NP_009557.1 Isoprenoid_Biosyn_C1 48..471 CDD:412224 56/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.