DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fpps and pdss1

DIOPT Version :9

Sequence 1:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001017656.1 Gene:pdss1 / 550349 ZFINID:ZDB-GENE-030131-4430 Length:411 Species:Danio rerio


Alignment Length:371 Identity:78/371 - (21%)
Similarity:126/371 - (33%) Gaps:113/371 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LVNEQKLKKT-SRTLSTLQNHSVPIAARVTVSKDESRDFMAVFPD----LVRDITTVTKAYNCSD 109
            |.::.|||.. |.....|||....|..::.|||.|.:.....:.|    ..|.:..:..|..|  
Zfish    82 LHSDAKLKDPFSLVQKDLQNIYDDIKQQLLVSKAELKALCDYYFDGKGKAFRPMIVILMARAC-- 144

  Fly   110 AAKWFAQVLQYNVPRGKKNRGILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDV 174
                       ||...|:  |:        |:|.|          :.:....||:.:..::.|||
Zfish   145 -----------NVHSNKE--GV--------LLPAQ----------RSIAMISEMIHTASLVHDDV 178

  Fly   175 MDNSTTRRGQPCWHKVENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHEITYITTCG 239
            :|:|..|||:           ..||:   :.....|||...|......:||..: ...|.::...
Zfish   179 IDDSDKRRGK-----------NTINN---VWGERKAILAGDFILSAASMALARI-GNTTVVSVLS 228

  Fly   240 QSLDQL------------NSNRCVSEFTMENYKAIVENKTAYYSFYLPFALALHLAGYKDAE--- 289
            |.::.|            |.|.....:..:.:|     |||  |.......|:.:....|.|   
Zfish   229 QVIEDLVRGEFMQLGSKENENERFKHYLEKTFK-----KTA--SLIANSCKAVSILVNSDPEVHE 286

  Fly   290 -AFRQSKTILLEMGNFFQVQDDFLD------CFGNPE--------VTGKIGTDIQ---------- 329
             |::..:.:    |..||:.||.||      |.|.|.        .||.:....|          
Zfish   287 IAYQYGRNV----GIAFQLVDDILDFTSNANCLGKPSAADLKLGLATGPVLFACQQFPELHSMIM 347

  Fly   330 -------DNKCSWLAVVAMQRANVEQKQIMVDCYGKEEPAKVERVK 368
                   |...:|..|  ::...|||...:...|.:|...::.|::
Zfish   348 RRFSSDGDVDRAWQYV--LKSDGVEQTNYLAQHYCQEAIRQISRLR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 61/297 (21%)
pdss1NP_001017656.1 PLN02890 26..411 CDD:178478 78/371 (21%)
Isoprenoid_Biosyn_C1 92..409 CDD:294142 74/361 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.