DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fpps and qless

DIOPT Version :9

Sequence 1:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster


Alignment Length:387 Identity:92/387 - (23%)
Similarity:152/387 - (39%) Gaps:67/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QKLKKTSRTLSTLQNHSVPIAARVTVSKDESRDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVL 118
            |.|:.:..:.:.|:.||   :..........|:|. :.|.::.|           |..|:|...:
  Fly    79 QSLQYSQSSKANLRQHS---SVHTQQPAGPVREFQ-IDPYIILD-----------DDLKYFYDDV 128

  Fly   119 QYNVPRGKKNRGILTVLTY------KNLVP----------TQDLTPENIKLA---QYLGWCVEML 164
            :|.:..|.....:.|:.:|      |.|.|          ...|..|:.:|.   :.:....||:
  Fly   129 RYLLKSGTSQPELDTIASYYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQIALFSEMV 193

  Fly   165 QSFFIISDDVMDNSTTRRGQP----CW-HKVENVGLTAIND-ALMIENAMYAILKKHFSHLDCYV 223
            .|..::.|||:|.|..|||:|    .| ||    .:|...| .|.|.:.|.|.|:..    |..:
  Fly   194 HSASLVHDDVIDQSDFRRGKPSVNALWNHK----KVTMAGDYILSIASIMIARLRSD----DVTI 250

  Fly   224 ALMELFHEITYITTCGQSLDQLNSNRCVSEFTMENYKAIVENKTA-YYSFYLPFALALHLAGYKD 287
            .|.::..::..    |:.: ||.|....:| ...:|......||| ..:..|.....:..|....
  Fly   251 VLSQILTDLVQ----GEFM-QLGSRETENE-RFAHYLTKTYRKTASLIANALKATAVIAQADDNV 309

  Fly   288 AE-AFRQSKTILLEMGNFFQVQDDFLDCFGNPEVTGK-IGTDIQDNKCSWLAVVAMQRANVEQKQ 350
            || ||:..:.|    |..||:.||.||...:.|..|| ...|::....:...:.|.::.......
  Fly   310 AEVAFQYGRNI----GLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFACEKYPELNPM 370

  Fly   351 IMVDCYGKEEPAKVERVKEL-YKELGLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQIL 411
            :|   ....||..|||..|| :|..||..|..:.::.....|:  :.|.....|:|..||::
  Fly   371 VM---RRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAIR--LAQELTESPYQKGLQVV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 72/286 (25%)
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 84/345 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.