DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fpps and pdss2

DIOPT Version :9

Sequence 1:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001002351.1 Gene:pdss2 / 436624 ZFINID:ZDB-GENE-040718-43 Length:370 Species:Danio rerio


Alignment Length:315 Identity:58/315 - (18%)
Similarity:101/315 - (32%) Gaps:109/315 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LRLQRLISTSDEVNAEPIIKSMDTIGGLPT-----------ELVN-----------EQKLKKTSR 61
            ||...:.|.....:...::...:.|.|.||           ||.|           :..|..|:|
Zfish    12 LRHLSIFSNPSPSSWTKVVSDAEKIVGYPTSFMSLRCLLSDELSNVAMHVRKLVGTKHPLLNTAR 76

  Fly    62 -----TLSTLQNHSVPI----AARVTVSKDESRDFM--AVFPDLVRDITTVTKAYNCSDAAKWFA 115
                 :.:.||...:.:    .|....|.|...|.|  .::|. .|::..:|:..:.:...    
Zfish    77 GFVYDSRNNLQMRGLVVLLMSKAAGPSSSDPIHDSMVSGIYPS-QRNLAEITELIHTAFLV---- 136

  Fly   116 QVLQYNVPRGKKNRGILTVLTYKNL-VPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNST 179
                        :|||:.:..:.|. .|.:|:...| |:|...|             |.::.|:.
Zfish   137 ------------HRGIVNLKEWTNSDGPLKDMQFGN-KMAVLSG-------------DFLLANAC 175

  Fly   180 TRRGQPCWHKVENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHE---------ITYI 235
            |             ||..:||..::|....||..          .:..::||         :|..
Zfish   176 T-------------GLAQLNDTKVVELISSAIGD----------VVQGIYHESSGSAEEDSLTVA 217

  Fly   236 TTCGQ---SLDQLNSNRCVSEFTMENYKAIVENKTAYYSFYLPFALALHLA-GYK 286
            :...|   |...|.:..|.:...:..:....:|        |.|....||| |:|
Zfish   218 SWEDQAFLSHGALLAKSCQAAMKLARHNTEAQN--------LAFQYGKHLALGHK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 35/182 (19%)
pdss2NP_001002351.1 Isoprenoid_Biosyn_C1 45..364 CDD:294142 51/282 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.