DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fpps and Ggps1

DIOPT Version :9

Sequence 1:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001007627.1 Gene:Ggps1 / 291211 RGDID:1359680 Length:300 Species:Rattus norvegicus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:116/274 - (42%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 EMLQSFFIISDDVMDNSTTRRGQPCWHKVENVGLTAINDALMIENAMYAI-LKK--HFSHLDCYV 223
            |||.:..::.||:.|:|..|||.|..|.:..|. :.||.|    |.:|.: |:|  ...|.|...
  Rat    54 EMLHNASLLIDDIEDSSKLRRGFPVAHSIYGVP-SVINSA----NYVYFLGLEKVLTLDHPDAVK 113

  Fly   224 ----ALMELFHEITYITTCGQSLD--QLNSNRCVSEFTMENYKAIVENKTAYYSFYLPFALALHL 282
                .|:|| |:       ||.||  ..::..|.:|   |.|||:|..||...     |.||:.|
  Rat   114 LFTRQLLEL-HQ-------GQGLDIYWRDTYTCPTE---EEYKAMVLQKTGGL-----FGLAVGL 162

  Fly   283 ----AGYKDAEAFRQSKTILLEMGNFFQVQDDFLDCFGNPEVTGK-IGTDIQDNKCSWLAVVAM- 341
                :.||:     ..|.:|..:|.|||::||:.:.........| ...|:.:.|.|:..:.|: 
  Rat   163 MQLFSDYKE-----DLKPLLDTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIW 222

  Fly   342 -------------QRA-NVEQKQIMVDCYGKEEPAKVE----RVKEL----YKEL----GLPSTY 380
                         ||. |::.|:..|...  |:....|    .::||    ||::    |.||..
  Rat   223 SRPESTQVQNILRQRTENIDIKKYCVQYL--EDVGSFEYTRYTLRELEAKAYKQIEACGGNPSLV 285

  Fly   381 AI-------FEEES 387
            |:       |.||:
  Rat   286 ALVKHLSKMFTEEN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 70/255 (27%)
Ggps1NP_001007627.1 polyprenyl_synt 9..251 CDD:395277 63/222 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.