DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fpps and PDSS1

DIOPT Version :9

Sequence 1:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_055132.2 Gene:PDSS1 / 23590 HGNCID:17759 Length:415 Species:Homo sapiens


Alignment Length:356 Identity:65/356 - (18%)
Similarity:133/356 - (37%) Gaps:64/356 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVLQYNVPRGKKNRGILTVLTYKNLVPTQDLTPE 149
            ||...::.|:.:::...|.  ...:.:::      |...:||..|.|:..|    :....::...
Human   101 RDLKGLYEDIRKELLISTS--ELKEMSEY------YFDGKGKAFRPIIVAL----MARACNIHHN 153

  Fly   150 NIKLAQ----YLGWCVEMLQSFFIISDDVMDNSTTRRGQPCWHKVENVGLTAINDALMIENAMYA 210
            |.:..|    .:....||:.:..::.|||:|::::|||:...:|:.......:...|::..|..|
Human   154 NSRHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIA 218

  Fly   211 ILKKHFSHLDCYVALMELFHEITYITTCGQSLDQL------------NSNRCVSEFTMENYKAIV 263
            :.:               ....|.|:...|.::.|            |.|...:.:..:.:|   
Human   219 LAR---------------IGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFK--- 265

  Fly   264 ENKTAYYSFYLPFALALHLAGYKDAE----AFRQSKTILLEMGNFFQVQDDFLDCFGNPEVTGK- 323
              |||  |.......|:.:.|..|..    |::..|.:    |..||:.||.||.....:..|| 
Human   266 --KTA--SLIANSCKAVSVLGCPDPVVHEIAYQYGKNV----GIAFQLIDDVLDFTSCSDQMGKP 322

  Fly   324 IGTDIQDNKCSWLAVVAMQRANVEQKQIMVDCYGKEEPAKVERVKE-LYKELGLPSTYAIFEEES 387
            ...|::....:...:.|.|:.......||   .....|..|:|.:: :.:..|:..|..:.::..
Human   323 TSADLKLGLATGPVLFACQQFPEMNAMIM---RRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYC 384

  Fly   388 YNMIKTHIQQTSRGVPHQTFLQILNKIYQRD 418
            :..|: .|.:..........:|:...:..||
Human   385 HEAIR-EISKLRPSPERDALIQLSEIVLTRD 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 55/279 (20%)
PDSS1NP_055132.2 PLN02890 6..415 CDD:178478 65/356 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..35
Isoprenoid_Biosyn_C1 102..413 CDD:294142 62/352 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.