DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7741 and CG9213

DIOPT Version :9

Sequence 1:NP_610670.2 Gene:CG7741 / 36208 FlyBaseID:FBgn0033615 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001285277.1 Gene:CG9213 / 32490 FlyBaseID:FBgn0030655 Length:687 Species:Drosophila melanogaster


Alignment Length:269 Identity:64/269 - (23%)
Similarity:119/269 - (44%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 KNDSSENRQYFYDMDGGRRKRQGGDNNKRDKRPRIPQIEQ-----DKCWFCLSSPDVEKHLIITV 356
            ||.:.:....|  .|..|::....|..||:.:..|.:.|:     |.|..|..|..::|.|::::
  Fly   428 KNPNDDLDDIF--ADKVRKQISASDAEKREMQSAIREHEKLVATLDNCERCFDSAKLDKQLLVSL 490

  Fly   357 GEHFYLALAKGP----INKHHVMILSTKHVPCAAQLSPDDWKELNKFKAALRKFFKTLGQVVCFT 417
            |:..||:|   |    :...|.::.:.:||||..||..|.|:|::.|:.||.:.|....|.|.|.
  Fly   491 GDKIYLSL---PWYMGLQSGHCILTTLQHVPCCTQLDEDAWEEISNFRKALTRMFAARRQDVVFY 552

  Fly   418 E---RHYKSVHLQINALAFE----EGYAWKIKHSFEDKAEEF--NLEFETLPALDSEKMLPEMGP 473
            |   :.::..||.::.:...    |...:..|.:.|:..:|:  |.:..:|........:|:..|
  Fly   553 EIANKLHRRPHLSVHCIPIPASQGEMAPFYFKKAIEESEQEWCINKQLVSLRQKSLRAAIPKGLP 617

  Fly   474 YFLAELPDDSTL--ITRQMKHFPIHFARDVFCSENLLNCDEKVNWKDCLLDKDEEVAYVEDFRKA 536
            |.......||..  :......||.:||:::......||.:.   |:....:.: .:..|:.|.:.
  Fly   618 YVWVHFGMDSGFAHVIEDEDRFPANFAQEILGGMLELNPNA---WRKPRKEAN-PIGKVKSFAEN 678

  Fly   537 FAPFDFTDD 545
            :..||.|.:
  Fly   679 WKKFDCTQN 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7741NP_610670.2 MPP_CWF19_N 29..249 CDD:277326
HIT_like 320..428 CDD:294158 36/119 (30%)
CwfJ_C_2 466..543 CDD:282523 16/78 (21%)
CG9213NP_001285277.1 CwfJ_C_1 460..584 CDD:282524 34/126 (27%)
CwfJ_C_2 593..685 CDD:282523 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455519
Domainoid 1 1.000 49 1.000 Domainoid score I2941
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.