DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Obp47b and Actn4

DIOPT Version :9

Sequence 1:	NP_610669.1	Gene:	Obp47b / 36207	FlyBaseID:	FBgn0033614	Length:	199	Species:	Drosophila melanogaster
Sequence 2:	XP_006540320.1	Gene:	Actn4 / 60595	MGIID:	1890773	Length:	934	Species:	Mus musculus

Alignment Length:	121	Identity:	27/121 - (22%)
Similarity:	42/121 - (34%)	Gaps:	39/121 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    73 DTAACLAECILTSSKYIDEPQKLNLANI----RSDLSAKFSNDTLYVETMTMAFS---KCEPQSQ 130
            |....|......:.||:|.|:.|:..:|    |.|..|..:    ||.:...|||   |.|..:.
Mouse   220 DPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMT----YVSSFYHAFSGAQKAETAAN 280

  Fly   131 R-------------------RLAMIMQQ---------QQQVQQQKTQQQQPRCSPF 158
            |                   |||..:.:         :.:|.|:..|:.|.:...|
Mouse   281 RICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDF 336

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Obp47b	NP_610669.1	None
Actn4	XP_006540320.1	SAC6	49..>312	CDD:227401	22/95 (23%)
		Spectrin	294..403	CDD:334073	8/43 (19%)
		SPEC	415..641	CDD:238103
		SPEC	533..755	CDD:238103
		FRQ1	763..>894	CDD:227455
		EFhand_Ca_insen	864..930	CDD:312305
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S11700
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950