DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47b and Obp58b

DIOPT Version :9

Sequence 1:NP_610669.1 Gene:Obp47b / 36207 FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster


Alignment Length:199 Identity:48/199 - (24%)
Similarity:84/199 - (42%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVIFASLALNTRLVFGQATIDCQRPPQLVDPAL--CCK-DGGRDQVAEQCAQRI---LGTANGQ 64
            ::.:..||.||..:.   ..:.|:...::.:..:  ||| ..|.|.|.|.||::.   |.:.| :
  Fly     7 VICVIISLRLNGLVA---VRVHCRHMERIHEENIHHCCKHQDGHDDVTESCAKQTNFRLPSPN-E 67

  Fly    65 KAGGPPSLDTA---ACLAECILTSSKYIDEPQKLNLANIRSDLSAKFSNDTLYVETMTMAFSKCE 126
            :|....::|.|   .|.|:|:......: |...|::..:||........|..|...|..|:.||.
  Fly    68 EAIVDVTVDQAMVGTCWAKCVFDHYNLM-ENNTLDMDKVRSYYKRYHQTDPEYATEMLNAYEKCH 131

  Fly   127 PQSQRRLAMIMQQQQQVQQQKTQQQQPRCSPFSAIVLGCTYMEYFKNCPDHRWTPNAQCTLAKAY 191
            .||:......:    .:...:.......|.|.|:|::.|....:|.|||..||:...:|....|:
  Fly   132 TQSEEATEKFL----SLPIVRAFSTAKFCKPTSSIIMSCVIYNFFHNCPASRWSNTTECVETLAF 192

  Fly   192 VTQC 195
            ..:|
  Fly   193 ARKC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp47bNP_610669.1 None
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 23/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.