DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47b and Obp50e

DIOPT Version :9

Sequence 1:NP_610669.1 Gene:Obp47b / 36207 FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610959.2 Gene:Obp50e / 36600 FlyBaseID:FBgn0033931 Length:196 Species:Drosophila melanogaster


Alignment Length:197 Identity:46/197 - (23%)
Similarity:76/197 - (38%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVIFASLALNTRLVFGQATIDCQRPPQL--VDPALCCKDGGRD--QVAEQCAQRILG--TANGQ 64
            |:::..||          |:.:|..||..  .|...||:....|  .|.::|.:.:.|  :||.:
  Fly    12 LIILECSL----------ASFNCSAPPNFNNFDINTCCRTPELDMGDVPQKCHKYVSGLKSANSK 66

  Fly    65 KAGGPPSLDTAACLAECILTSSKYIDEPQKLNLANIRSDLSAK-FSNDTLYVETMTMAFSKCEPQ 128
            .    ||. ...|..:||...:..:.. .|:.:..::..|... ...|...|..:..:|..|   
  Fly    67 Y----PSY-AHLCYPDCIYRETGAMVN-GKIKVNRVKQYLEEHVHRRDQEIVSHIVQSFESC--- 122

  Fly   129 SQRRLAMIMQQQQQVQQQKTQQQQPRCSPFSAIVLGCTYMEYFKNCPDHRWTPNAQCTLAKAYVT 193
                |:.:....:.:..:..:.....||||:.|:..|...|.|.|||...|.....|.|||.:..
  Fly   123 ----LSNVKGHMKSLNIESYKVLPHGCSPFAGIIYSCVNAETFLNCPQQMWKNEKPCNLAKQFAE 183

  Fly   194 QC 195
            ||
  Fly   184 QC 185



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.