DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18335 and FAM166B

DIOPT Version :9

Sequence 1:NP_610666.1 Gene:CG18335 / 36202 FlyBaseID:FBgn0033610 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001274168.1 Gene:FAM166B / 730112 HGNCID:34242 Length:306 Species:Homo sapiens


Alignment Length:323 Identity:74/323 - (22%)
Similarity:112/323 - (34%) Gaps:101/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITPE-PHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVAPIHAKRGL-------- 60
            :.|: ||.:|||||||...|..||:|||:.|.:||..|     |.|...|:|  |.|        
Human    11 LNPQNPHYIPGYTGHCPLLRFSVGQTYGQVTGQLLRGP-----PGLAWPPVH--RTLLPPIRPPR 68

  Fly    61 -KDYPTEQELKILRTREGLVDSVYRHPILPGYAGFVPNKVSQIGKRYVAAASAGVARHETLMELY 124
             .:.|.| .|.:.|.:|.|..|     ::|||.||||.      .:::.|.:......|.|.:..
Human    69 SPEVPRE-SLPVRRGQERLSSS-----MIPGYTGFVPR------AQFIFAKNCSQVWAEALSDFT 121

  Fly   125 RCENRTLRHRDLLESGNGLFDRKINERLLPQTYYRSPLILVTGVSKGIKDETCPPKTEKLCYSKF 189
            ....:. ...:|.:...|..|.:.::...|:.....|.:.|.                     :.
Human   122 HLHEKQ-GSEELPKEAKGRKDTEKDQVPEPEGQLEEPTLEVV---------------------EQ 164

  Fly   190 TSPHFLEDEDADKFIINGYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRDTWCCGQDLSR 254
            .||:.::|.|..||.::.:                      |||                     
Human   165 ASPYSMDDRDPRKFFMSAF----------------------LCS--------------------- 186

  Fly   255 PSITCPPVGHFVVYHEDSGMVPNYAGHVPGETYK---FGRTYAKTTYDAKRWLEVHKNLTVLP 314
            |:..|..:|...  |:.....||.:.|.|..|.:   |..|...|.......|..|  |.:.|
Human   187 PTRHCRNLGRST--HQAVPRTPNISPHFPEHTLRTWVFYLTMGATCQGISSSLATH--LAISP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18335NP_610666.1 DUF2475 8..>41 CDD:287584 18/33 (55%)
DUF2475 271..>297 CDD:287584 7/28 (25%)
FAM166BNP_001274168.1 DUF2475 16..72 CDD:287584 25/62 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..84 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..169 8/65 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12101
eggNOG 1 0.900 - - E1_29KHB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4965
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52846
OrthoDB 1 1.010 - - D497432at33208
OrthoFinder 1 1.000 - - FOG0008107
OrthoInspector 1 1.000 - - oto90255
orthoMCL 1 0.900 - - OOG6_109205
Panther 1 1.100 - - LDO PTHR22146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6047
SonicParanoid 1 1.000 - - X7065
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.