DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18335 and Fam166a

DIOPT Version :9

Sequence 1:NP_610666.1 Gene:CG18335 / 36202 FlyBaseID:FBgn0033610 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_006498328.1 Gene:Fam166a / 68222 MGIID:3605773 Length:329 Species:Mus musculus


Alignment Length:352 Identity:74/352 - (21%)
Similarity:127/352 - (36%) Gaps:108/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TPEPHLVPG----------YTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVAPIHAKRGL 60
            |||||.:||          |.|...|.|.:||.||||.|.:||.||.:..:|..:::|:...:.:
Mouse    11 TPEPHYIPGSGFSPASPHSYAGFYPQLRYQVGNTYGRTTAQLLTDPSVQKSPCSVLSPMTKPKFI 75

  Fly    61 KDYPTEQELKILRTREGLVDSVYRHPILPGYAGFVPNKVSQIGKRYVAAASAGVARHETLMELYR 125
            :|: ::.:...:..|:      .|.|.:|.|....|.|                 ..|.|.:|.|
Mouse    76 EDF-SKSKPPWIPCRD------LREPYIPHYTSLKPYK-----------------NFEILGQLPR 116

  Fly   126 ----------CENRTLRHRDLLESGNGLFDRKINERLLPQTYYRS--------------PLILVT 166
                      .|||    :..|.:|           .:|...|.:              |.:|:.
Mouse   117 QDVDTQGPPQVENR----QGPLTAG-----------FMPYPPYPACPPGRKGEARDLGHPGLLLA 166

  Fly   167 GVSKGIKD----ETCPPKTEKLCY---SKFTSPHFLEDE-DADKF---------------IINGY 208
            ...:..||    :..|.|..:|.:   .::..||..::. |..:|               .|:||
Mouse   167 YGEEAWKDAAPLQDTPGKNNQLYHCRRDEYLPPHPPQETLDVGRFQRLPQLDHPNLIQRKAISGY 231

  Fly   209 SGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRDTWCCGQDLSR---PSITCPPVGHFVVYHE 270
            :|.:|......|.:.:....:|:..|....:..:......|:.|.|   |:.|         .:.
Mouse   232 AGFVPRFAWVMGMNYRDGVTQAMDDFDKNQFVFRHPVCALGERLPRTHWPNTT---------IYR 287

  Fly   271 DSGMVPNYAGHVPGETYKFGRTYAKTT 297
            ..|::|.|.|.:|.....:..|:..:|
Mouse   288 SQGLIPFYMGFIPSMQDNYALTFGNST 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18335NP_610666.1 DUF2475 8..>41 CDD:287584 18/42 (43%)
DUF2475 271..>297 CDD:287584 6/25 (24%)
Fam166aXP_006498328.1 DUF2475 13..>55 CDD:371169 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12380
eggNOG 1 0.900 - - E1_29KHB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6047
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.