DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18335 and Fam166b

DIOPT Version :9

Sequence 1:NP_610666.1 Gene:CG18335 / 36202 FlyBaseID:FBgn0033610 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_796351.2 Gene:Fam166b / 329831 MGIID:2445194 Length:379 Species:Mus musculus


Alignment Length:311 Identity:75/311 - (24%)
Similarity:119/311 - (38%) Gaps:84/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPEL--------IVAPIHAKRGLKDYP- 64
            ||.:|||||||...|..:|:|||:.|.:||..|     |.|        ::.||.:.|.    | 
Mouse    16 PHYIPGYTGHCPLLRFSMGQTYGQVTGQLLRGP-----PGLAWPPAHRTLLPPIQSPRS----PV 71

  Fly    65 -TEQELKILRTREGLVDSVYRHPILPGYAGFVPNKVSQIGKRYVAAASAGVARHETLMELYRCEN 128
             ::..|...|..|.|..|     |:|||.||:|.      .:::.|.:......|.:.|..|...
Mouse    72 ISKGRLPPRRGHERLSSS-----IIPGYTGFIPR------AQFIFAKNCNQVWAEAMSEFTRRHG 125

  Fly   129 RTLRHRDLLESGNGLFDRKINERLLPQTYYRSPLILVTGVSKGIKDETCPPKTEKLCYSKFTSPH 193
            ....|: |.:...|  :|::.|..|                   ::...||..::|.::   ||:
Mouse   126 EQESHQ-LPDGAKG--EREVEEDQL-------------------REAEEPPLKQELAHA---SPY 165

  Fly   194 FLEDEDADKFIINGYSGHIPMSVTRFGESNKVLT--------NRALCSFSDYMYKRKRDTWCCGQ 250
            .::|.|..||.::|....:  :....|....|||        :||:|...             ..
Mouse   166 SMDDTDPHKFFMSGERKWV--ATKGEGRPQDVLTQHLPHPQVSRAMCPVP-------------AS 215

  Fly   251 DLSRPSITCPPVGHF-----VVYHEDSGMVPNYAGHVPGETYKFGRTYAKT 296
            .|: |:..|.|..|.     ..:.......||.:.|.||..::...:|..|
Mouse   216 SLA-PASLCLPTRHCRNLGRCAHGAGRTRTPNLSPHFPGPRFRIWVSYLTT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18335NP_610666.1 DUF2475 8..>41 CDD:287584 17/31 (55%)
DUF2475 271..>297 CDD:287584 7/26 (27%)
Fam166bNP_796351.2 DUF2475 16..>85 CDD:371169 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11449
eggNOG 1 0.900 - - E1_29KHB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4984
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52846
OrthoDB 1 1.010 - - D497432at33208
OrthoFinder 1 1.000 - - FOG0008107
OrthoInspector 1 1.000 - - oto93834
orthoMCL 1 0.900 - - OOG6_109205
Panther 1 1.100 - - LDO PTHR22146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6047
SonicParanoid 1 1.000 - - X7065
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.