DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18335 and fam166b

DIOPT Version :9

Sequence 1:NP_610666.1 Gene:CG18335 / 36202 FlyBaseID:FBgn0033610 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001076489.2 Gene:fam166b / 100009651 ZFINID:ZDB-GENE-070209-41 Length:299 Species:Danio rerio


Alignment Length:329 Identity:91/329 - (27%)
Similarity:149/329 - (45%) Gaps:73/329 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITPEPHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIV--APIHAKRGLKDYPTEQ 67
            :||:|..:|||.|:|.|.:..||:|||:.|.|||..|.:.|:..|::  :|:.:        ||:
Zfish    13 VTPDPQYIPGYAGYCPQLKYHVGQTYGQLTAKLLTSPEVSHSQRLVLQTSPLSS--------TEK 69

  Fly    68 EL----KILRTREGLVDSVYRHPILPGYAGFVPNKVSQIGKRYVAAASAGVARHETLMELYRCEN 128
            |.    :|..:|.|...::  ..::|||.||||.:.:.|.|.|....      .:.|.|..:.:.
Zfish    70 ETASRSQIWWSRHGASRNL--ETMIPGYTGFVPLRQNYICKTYAETC------RDALSEFNQEQA 126

  Fly   129 RTLRHRD------LLESGNGLFDRKINERLLPQTYYRSPLILVTGVSKGIK--DETCPPKTEKLC 185
            :.|.:..      ::.|......|:.|          ||||.::......|  |...||      
Zfish   127 KRLHNASADLSFPVINSVPDFRPRRSN----------SPLIALSKDPAPYKAPDPWKPP------ 175

  Fly   186 YSKFTSPHFLEDEDADKFIINGYSGHIPMSVTRFGESNKVLTNRALCSFSDYM---------YKR 241
                .||:|:||....|:.|:|::|::|.:...||.....:||:||..||..|         |..
Zfish   176 ----GSPYFMEDSSPHKYFISGFTGYVPKARFLFGTGYPTITNKALIQFSKEMKAGPASLQKYSL 236

  Fly   242 KRDTWCCGQDLSR-PSITCPPVGHFVVYHEDSGMVPNYAGHVPGETYKFGRTYAKTTYDAKRWLE 305
            :.      :|.|. |.|.       .:|...:|::|:|.||:||..:::|.|:.|.|::|.....
Zfish   237 QE------EDSSNLPLIP-------TIYPSKTGLLPSYTGHIPGYRFQYGHTFGKLTHNALGHTA 288

  Fly   306 VHKN 309
            ..||
Zfish   289 SQKN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18335NP_610666.1 DUF2475 8..>41 CDD:287584 16/32 (50%)
DUF2475 271..>297 CDD:287584 10/25 (40%)
fam166bNP_001076489.2 DUF2475 16..>63 CDD:287584 19/46 (41%)
DUF2475 256..>281 CDD:287584 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11747
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H135733
Inparanoid 1 1.050 114 1.000 Inparanoid score I4818
OMA 1 1.010 - - QHG52846
OrthoDB 1 1.010 - - D497432at33208
OrthoFinder 1 1.000 - - FOG0008107
OrthoInspector 1 1.000 - - oto38996
orthoMCL 1 0.900 - - OOG6_109205
Panther 1 1.100 - - LDO PTHR22146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6047
SonicParanoid 1 1.000 - - X7065
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.