DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13220 and C09G9.1

DIOPT Version :9

Sequence 1:NP_001260887.1 Gene:CG13220 / 36200 FlyBaseID:FBgn0033608 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_501536.1 Gene:C09G9.1 / 177702 WormBaseID:WBGene00007492 Length:416 Species:Caenorhabditis elegans


Alignment Length:115 Identity:40/115 - (34%)
Similarity:66/115 - (57%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PFTRDNVFNYYIPLHGLVSYGALAVNVMNPQIVPKILPKKDL--TNVFLISAVVGSAFYIYGRPH 82
            |.|..:..::|:|..|.:|:....|::.:|.|:..:.|..||  :|..|.:|.||..||:|.|.|
 Worm    30 PVTSRSFLSHYLPASGALSHTLYTVHLFSPNIISSLFPTGDLAVSNTILFNANVGLGFYVYFRRH 94

  Fly    83 LKDVKNNKRGAYALLGATLFSMGSVLAWALIKSALPQDN-----ALLATL 127
            |..|...:|..:::|.:|||:.||:||..|||:.:|..:     :|.||:
 Worm    95 LHRVNPWERVEFSVLSSTLFNFGSLLAAVLIKALIPAKSPTWLKSLTATV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13220NP_001260887.1 DUF1129 <61..119 CDD:159539 25/59 (42%)
C09G9.1NP_501536.1 PLN02217 <158..251 CDD:215130
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016831
OrthoInspector 1 1.000 - - oto20047
orthoMCL 1 0.900 - - OOG6_115651
Panther 1 1.100 - - LDO PTHR38640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.