DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9067 and RGD1564492

DIOPT Version :9

Sequence 1:NP_610662.1 Gene:CG9067 / 36197 FlyBaseID:FBgn0033605 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_017447851.1 Gene:RGD1564492 / 498914 RGDID:1564492 Length:109 Species:Rattus norvegicus


Alignment Length:105 Identity:58/105 - (55%)
Similarity:82/105 - (78%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNAALDVVEEKCLI-GKGAPESKELYLGLLYSTENHKIYGFVTNTRVKFIVVIDSSNVALRENEV 95
            |:.:||||:||... ||...:.:||||||||.||::|:||:|||::|||::|:||||.|||:||:
  Rat     2 VHTSLDVVDEKISAKGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEI 66

  Fly    96 RAIFRNLHLLYTDAICNPFYIPGESLTSKKFDRAVQKLMS 135
            |::||.||..|||.:|||||.||:.:.|:.||..|..:|:
  Rat    67 RSMFRKLHNSYTDVMCNPFYNPGDRIQSRAFDTMVTSMMA 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9067NP_610662.1 Sedlin_N 7..134 CDD:282482 57/102 (56%)
RGD1564492XP_017447851.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.