DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9067 and trappc2l

DIOPT Version :9

Sequence 1:NP_610662.1 Gene:CG9067 / 36197 FlyBaseID:FBgn0033605 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001003506.2 Gene:trappc2l / 445112 ZFINID:ZDB-GENE-040801-249 Length:139 Species:Danio rerio


Alignment Length:135 Identity:73/135 - (54%)
Similarity:102/135 - (75%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFCIAVIGKDNAPLYLTTSDMEQELELQYHVNAALDVVEEKCL-IGKGAPESKELYLGLLYSTE 64
            ||.|||||.|:|.|||:.:...:.||:..|.|:.:|||||||.. :||...:.:||||||||.||
Zfish     1 MAVCIAVIAKENYPLYIRSVPTQGELKFHYTVHTSLDVVEEKISGVGKALADQRELYLGLLYPTE 65

  Fly    65 NHKIYGFVTNTRVKFIVVIDSSNVALRENEVRAIFRNLHLLYTDAICNPFYIPGESLTSKKFDRA 129
            ::|:||:|||::|||::|:||||.:||:||:|::||.||..:||.:|||||.||:.:.||.||..
Zfish    66 DYKVYGYVTNSKVKFVIVVDSSNTSLRDNEIRSMFRKLHNSFTDVMCNPFYNPGDPIQSKAFDGI 130

  Fly   130 VQKLM 134
            |..:|
Zfish   131 VSAMM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9067NP_610662.1 Sedlin_N 7..134 CDD:282482 67/127 (53%)
trappc2lNP_001003506.2 Sedlin_N 7..135 CDD:282482 67/127 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595863
Domainoid 1 1.000 148 1.000 Domainoid score I4429
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9424
Inparanoid 1 1.050 158 1.000 Inparanoid score I4239
OMA 1 1.010 - - QHG54366
OrthoDB 1 1.010 - - D1549524at2759
OrthoFinder 1 1.000 - - FOG0004916
OrthoInspector 1 1.000 - - oto39887
orthoMCL 1 0.900 - - OOG6_103373
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4584
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.