DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9067 and T10F2.5

DIOPT Version :9

Sequence 1:NP_610662.1 Gene:CG9067 / 36197 FlyBaseID:FBgn0033605 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001033370.1 Gene:T10F2.5 / 3896754 WormBaseID:WBGene00044604 Length:137 Species:Caenorhabditis elegans


Alignment Length:139 Identity:45/139 - (32%)
Similarity:82/139 - (58%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAVIG-----KDNAPLYLTTSD--MEQELELQYHVNAALDVVEEKCLIGKGAPESKELYLGLLYS 62
            :.|:|     |:|:.|:.:.:.  .:|.||::.....:||:|:||      :.::.|::||.||:
 Worm     2 LGVVGFFIYAKENSRLFDSVNPRYAQQLLEIEMFTFCSLDIVDEK------STKASEMFLGQLYN 60

  Fly    63 TENHKIYGFVTNTRVKFIVVIDSSNVA-LRENEVRAIFRNLHLLYTDAICNPFYIPGESLTSKKF 126
            .:..:.:|::|||.|:.|:|:|:::.| |::.|:|.||:..|..|.:.|.||||..|..:.||..
 Worm    61 DQKWRSFGYITNTGVRMILVLDATSAASLKDQEIRLIFKRFHGHYCNTISNPFYEIGTPMQSKWL 125

  Fly   127 DRAVQKLMS 135
            |..:..|.|
 Worm   126 DEGINDLYS 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9067NP_610662.1 Sedlin_N 7..134 CDD:282482 43/134 (32%)
T10F2.5NP_001033370.1 Pneumo_ncap <2..62 CDD:281264 18/65 (28%)
Sedlin_N <38..133 CDD:304437 35/100 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167192
Domainoid 1 1.000 77 1.000 Domainoid score I5759
eggNOG 1 0.900 - - E1_KOG3444
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I3795
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54366
OrthoDB 1 1.010 - - D1549524at2759
OrthoFinder 1 1.000 - - FOG0004916
OrthoInspector 1 1.000 - - oto17760
orthoMCL 1 0.900 - - OOG6_103373
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1779
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.