DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9067 and SPAC15A10.12c

DIOPT Version :9

Sequence 1:NP_610662.1 Gene:CG9067 / 36197 FlyBaseID:FBgn0033605 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_594299.2 Gene:SPAC15A10.12c / 2542766 PomBaseID:SPAC15A10.12c Length:148 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:42/137 - (30%)
Similarity:76/137 - (55%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAVIGKDNAPLYLTTSDMEQE---LELQYHVNAALDVVEEKCLIGKGAPESKELYLGLLYSTENH 66
            :::.|..:..|||...|.:::   ...||....:|||:.:  |:..|...|.:.:||||...|:.
pombe     9 LSIAGPKDEQLYLEIIDPKEKHLLARYQYLGELSLDVIND--LVNDGERTSNDCFLGLLGVEEDI 71

  Fly    67 KIYGFVTNTRVKFIVVIDSSNVALRENEVRAIFRNLHLLYTDAICNPFYI---PGESLTSKKFDR 128
            ..|.|.:||:||||:.:.:.:..::|.|:|.:.|.::.::|.|:||||.:   |....||..|..
pombe    72 STYAFYSNTKVKFILAVKAPDYVVKETEIRQLLRRIYTIHTHAVCNPFSMDLTPETLKTSIYFKE 136

  Fly   129 AVQKLMS 135
            ::.:|:|
pombe   137 SLHQLIS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9067NP_610662.1 Sedlin_N 7..134 CDD:282482 40/132 (30%)
SPAC15A10.12cNP_594299.2 Sedlin_N 11..142 CDD:304437 40/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I2640
eggNOG 1 0.900 - - E1_KOG3444
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1904
OMA 1 1.010 - - QHG54366
OrthoFinder 1 1.000 - - FOG0004916
OrthoInspector 1 1.000 - - oto101789
orthoMCL 1 0.900 - - OOG6_103373
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1779
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.