powered by:
Protein Alignment CG9067 and trpp-4
DIOPT Version :9
Sequence 1: | NP_610662.1 |
Gene: | CG9067 / 36197 |
FlyBaseID: | FBgn0033605 |
Length: | 138 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505435.1 |
Gene: | trpp-4 / 185357 |
WormBaseID: | WBGene00018088 |
Length: | 224 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 24/74 - (32%) |
Similarity: | 42/74 - (56%) |
Gaps: | 7/74 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 TENHKIYGFVTNTRVKFIVVID-SSNVALRENEVRAIFRNLHLLYTD-AICNPFYIPGESLTSKK 125
|...|::...:.|.|||:|:.. :||:| ..::...::.|||| |:.||||.....:.::|
Worm 144 TTQFKLFCLQSRTGVKFVVITSAASNIA-----ADSLLSKMYELYTDFALKNPFYSIDMPIRAQK 203
Fly 126 FDRAVQKLM 134
||.|::.|:
Worm 204 FDEAIKTLL 212
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.