DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9067 and trpp-4

DIOPT Version :9

Sequence 1:NP_610662.1 Gene:CG9067 / 36197 FlyBaseID:FBgn0033605 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_505435.1 Gene:trpp-4 / 185357 WormBaseID:WBGene00018088 Length:224 Species:Caenorhabditis elegans


Alignment Length:74 Identity:24/74 - (32%)
Similarity:42/74 - (56%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TENHKIYGFVTNTRVKFIVVID-SSNVALRENEVRAIFRNLHLLYTD-AICNPFYIPGESLTSKK 125
            |...|::...:.|.|||:|:.. :||:|     ..::...::.|||| |:.||||.....:.::|
 Worm   144 TTQFKLFCLQSRTGVKFVVITSAASNIA-----ADSLLSKMYELYTDFALKNPFYSIDMPIRAQK 203

  Fly   126 FDRAVQKLM 134
            ||.|::.|:
 Worm   204 FDEAIKTLL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9067NP_610662.1 Sedlin_N 7..134 CDD:282482 23/72 (32%)
trpp-4NP_505435.1 Sybindin 5..215 CDD:282019 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.