DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and LOC4578106

DIOPT Version :10

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_001238070.3 Gene:LOC4578106 / 4578106 VectorBaseID:AGAMI1_007234 Length:334 Species:Anopheles gambiae


Alignment Length:102 Identity:36/102 - (35%)
Similarity:54/102 - (52%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DANVLRAEQQV---NVDGFAYAVELDNSVNVQQKG---DLNGEEWVV--KGSQSWTSPENVPVSI 75
            ||...:.::||   |.||:.|....:|::...:.|   |.|.|...:  ||...:...:.....:
Mosquito   231 DAGYEKIKEQVKQFNDDGYYYKYANENNIEAAESGKIDDRNTENETLRAKGYYEYIGDDGQKYRV 295

  Fly    76 QYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIAA 112
            .|:||.||:|.:..:  ||||||.||.|.|:|||||:
Mosquito   296 DYVADENGFQPLGDH--LPTPPPTPEPIARALEYIAS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 12/54 (22%)
LOC4578106XP_001238070.3 Chitin_bind_4 249..304 CDD:459790 12/54 (22%)

Return to query results.
Submit another query.