DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Cpr97Eb

DIOPT Version :10

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster


Alignment Length:79 Identity:22/79 - (27%)
Similarity:34/79 - (43%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLRAEQQVNVDG-FAYAVE-LDNSVNVQQKGDLNGEEWVVKGSQSWTSPENVPVSIQYIADANGY 84
            :|:...:.|.|| :.|..| .|.|..::.| ..|||   |.|...:...:.....|:|.|...|:
  Fly    31 ILKQIDKHNDDGSYTYGYEAADKSFKIETK-YANGE---VYGKYGYVDDQGKVREIEYGASKRGF 91

  Fly    85 QVVSANPPLPTPPP 98
            :  .|...:..|||
  Fly    92 E--PAGSHINVPPP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 13/50 (26%)
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 13/50 (26%)

Return to query results.
Submit another query.