DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Cpr97Ea

DIOPT Version :9

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:145 Identity:30/145 - (20%)
Similarity:46/145 - (31%) Gaps:55/145 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLRAEQQVNVDG-FAYAVE-LDNSVNVQQKGDLNGEEWVVKGSQSWTSPENVPVSIQYIADANGY 84
            :|:...:.|.|| :.|..| .|.|..::.| ...||   |||...:.........::|.|:..|:
  Fly    59 ILKQINKHNEDGSYTYGYEGADGSFKIETK-LATGE---VKGKYGYVDETGKVRVVEYGANKYGF 119

  Fly    85 Q-----VVSANP------------------------------------PLPTPPPIPEAIQ---- 104
            |     :..|.|                                    |.|.|.|.|:.:|    
  Fly   120 QPSGEGITVAPPTLVDETLKEEPDYADEPAPQRPQKPYRVQRPQPRPQPRPQPQPQPQYVQYEVE 184

  Fly   105 ----RSLEYIAAHPP 115
                |.::|..|..|
  Fly   185 EESPRRVQYAPAPQP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 12/50 (24%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.